PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aco005568.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Bromeliaceae; Ananas
Family WRKY
Protein Properties Length: 217aa    MW: 23360.4 Da    PI: 8.86
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aco005568.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY103.21.4e-32137195159
                  ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
         WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                  ldDgy+WrKYGqK vk+s +prsYYrCt+++C+vkk+v+r a+d+++v++tYeg Hnh+
  Aco005568.1 137 LDDGYRWRKYGQKAVKNSACPRSYYRCTHHTCNVKKQVQRLAKDTSIVVTTYEGVHNHP 195
                  59********************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.803.9E-33123195IPR003657WRKY domain
SuperFamilySSF1182902.62E-28130196IPR003657WRKY domain
PROSITE profilePS5081128.346132197IPR003657WRKY domain
SMARTSM007748.2E-38137196IPR003657WRKY domain
PfamPF031067.9E-26138195IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 217 aa     Download sequence    Send to blast
MEPLEGEAVP NPHFPYISTP LAPPPSSSLY YPPTLSNVAV VAEHDPPTAP PPPPIGPTVA  60
ADMDWASLLL SSSMTPQQPL TQGLGLDTGT GKGSEGEDNG GSGSSSSAKE KGKGLGRGKK  120
VTRPRFAFQT RSANDILDDG YRWRKYGQKA VKNSACPRSY YRCTHHTCNV KKQVQRLAKD  180
TSIVVTTYEG VHNHPCEKLM EALSPLLKQI QFLSQF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A2e-23127194774Probable WRKY transcription factor 4
2lex_A2e-23127194774Probable WRKY transcription factor 4
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00539DAPTransfer from AT5G41570Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008775118.14e-79PREDICTED: probable WRKY transcription factor 24
SwissprotQ9FFS35e-57WRK24_ARATH; Probable WRKY transcription factor 24
TrEMBLA0A067HEP84e-70A0A067HEP8_CITSI; Uncharacterized protein
TrEMBLK7VQ787e-70K7VQ78_MAIZE; Putative WRKY DNA-binding domain superfamily protein
TrEMBLM7Z1806e-70M7Z180_TRIUA; Putative WRKY transcription factor 24
STRINGGRMZM2G111354_P012e-69(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP110038133
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G41570.14e-55WRKY DNA-binding protein 24